Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 170955..171460 | Replicon | chromosome |
| Accession | NZ_CP096909 | ||
| Organism | Pseudomonas aeruginosa strain NY8688 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A069QL22 |
| Locus tag | M2J77_RS00750 | Protein ID | WP_003121619.1 |
| Coordinates | 170955..171236 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q9I707 |
| Locus tag | M2J77_RS00755 | Protein ID | WP_003112628.1 |
| Coordinates | 171233..171460 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2J77_RS00725 (M2J77_00725) | 166206..167555 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| M2J77_RS00730 (M2J77_00730) | 167604..168290 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| M2J77_RS00735 (M2J77_00735) | 168391..169125 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| M2J77_RS00740 (M2J77_00740) | 169305..169715 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| M2J77_RS00745 (M2J77_00745) | 169747..170655 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| M2J77_RS00750 (M2J77_00750) | 170955..171236 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| M2J77_RS00755 (M2J77_00755) | 171233..171460 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| M2J77_RS00760 (M2J77_00760) | 171636..172256 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| M2J77_RS00765 (M2J77_00765) | 172357..172857 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| M2J77_RS00770 (M2J77_00770) | 172930..173271 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| M2J77_RS00775 (M2J77_00775) | 173353..174780 | - | 1428 | WP_003121620.1 | GABA permease | - |
| M2J77_RS00780 (M2J77_00780) | 174949..176442 | - | 1494 | WP_031653061.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T244143 WP_003121619.1 NZ_CP096909:c171236-170955 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A069QL22 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6XRW | |
| AlphaFold DB | Q9I707 |