Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4686683..4687311 | Replicon | chromosome |
Accession | NZ_CP096905 | ||
Organism | Citrobacter amalonaticus strain RSHH22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7L6UNG2 |
Locus tag | M2R49_RS22510 | Protein ID | WP_044328134.1 |
Coordinates | 4686683..4687069 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M2R49_RS22515 | Protein ID | WP_161215612.1 |
Coordinates | 4687069..4687311 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2R49_RS22490 (M2R49_22470) | 4682036..4683373 | + | 1338 | WP_086512772.1 | VWA domain-containing protein | - |
M2R49_RS22495 (M2R49_22475) | 4683391..4684887 | + | 1497 | WP_044265164.1 | HAMP domain-containing sensor histidine kinase | - |
M2R49_RS22500 (M2R49_22480) | 4684892..4685578 | + | 687 | WP_054177415.1 | response regulator transcription factor | - |
M2R49_RS22505 (M2R49_22485) | 4685723..4686652 | + | 930 | WP_054177416.1 | formate dehydrogenase accessory protein FdhE | - |
M2R49_RS22510 (M2R49_22490) | 4686683..4687069 | - | 387 | WP_044328134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M2R49_RS22515 (M2R49_22495) | 4687069..4687311 | - | 243 | WP_161215612.1 | CopG family transcriptional regulator | Antitoxin |
M2R49_RS22520 (M2R49_22500) | 4687519..4688445 | + | 927 | WP_054177417.1 | alpha/beta hydrolase | - |
M2R49_RS22525 (M2R49_22505) | 4688461..4689402 | - | 942 | WP_042998862.1 | fatty acid biosynthesis protein FabY | - |
M2R49_RS22530 (M2R49_22510) | 4689447..4689884 | - | 438 | WP_044265155.1 | D-aminoacyl-tRNA deacylase | - |
M2R49_RS22535 (M2R49_22515) | 4689881..4690753 | - | 873 | WP_044257165.1 | virulence factor BrkB family protein | - |
M2R49_RS22540 (M2R49_22520) | 4690747..4691346 | - | 600 | WP_044265152.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14394.61 Da Isoelectric Point: 8.4794
>T244141 WP_044328134.1 NZ_CP096905:c4687069-4686683 [Citrobacter amalonaticus]
MQKGPVLFDTNILIDLFSGHQEAQHVLEAYPPQNAISLVTWMEVMVGAKKYHQEYRTRVALSAFNIIGVSQEIAERSVNL
RQEYGMKLPDAIILATAQIHRFALVTRNTRDFAGIPGVITPYQLQAGR
MQKGPVLFDTNILIDLFSGHQEAQHVLEAYPPQNAISLVTWMEVMVGAKKYHQEYRTRVALSAFNIIGVSQEIAERSVNL
RQEYGMKLPDAIILATAQIHRFALVTRNTRDFAGIPGVITPYQLQAGR
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|