Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3997794..3998448 | Replicon | chromosome |
| Accession | NZ_CP096905 | ||
| Organism | Citrobacter amalonaticus strain RSHH22 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3Q8D714 |
| Locus tag | M2R49_RS19320 | Protein ID | WP_044254016.1 |
| Coordinates | 3997794..3998201 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A0F6TWP9 |
| Locus tag | M2R49_RS19325 | Protein ID | WP_042322123.1 |
| Coordinates | 3998182..3998448 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2R49_RS19300 (M2R49_19285) | 3993699..3995432 | - | 1734 | WP_042999369.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M2R49_RS19305 (M2R49_19290) | 3995438..3996151 | - | 714 | WP_054176762.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M2R49_RS19310 (M2R49_19295) | 3996175..3997071 | - | 897 | WP_042999367.1 | site-specific tyrosine recombinase XerD | - |
| M2R49_RS19315 (M2R49_19300) | 3997172..3997693 | + | 522 | WP_042999366.1 | flavodoxin FldB | - |
| M2R49_RS19320 (M2R49_19305) | 3997794..3998201 | - | 408 | WP_044254016.1 | protein YgfX | Toxin |
| M2R49_RS19325 (M2R49_19310) | 3998182..3998448 | - | 267 | WP_042322123.1 | FAD assembly factor SdhE | Antitoxin |
| M2R49_RS19330 (M2R49_19315) | 3998705..3999685 | + | 981 | WP_044254013.1 | tRNA-modifying protein YgfZ | - |
| M2R49_RS19335 (M2R49_19320) | 3999766..4000425 | - | 660 | WP_263504052.1 | hemolysin III family protein | - |
| M2R49_RS19340 (M2R49_19325) | 4000588..4000899 | - | 312 | WP_054176763.1 | N(4)-acetylcytidine aminohydrolase | - |
| M2R49_RS19345 (M2R49_19330) | 4000952..4001680 | + | 729 | WP_044254008.1 | MurR/RpiR family transcriptional regulator | - |
| M2R49_RS19350 (M2R49_19335) | 4001800..4003233 | + | 1434 | WP_054176764.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15863.86 Da Isoelectric Point: 11.6030
>T244139 WP_044254016.1 NZ_CP096905:c3998201-3997794 [Citrobacter amalonaticus]
VVLWQSDLRVSWRAQWLSLLLHGLVAAAILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINARQGEVKLLMDGRLRWQGQ
DWLIVSAPWMIKTGMMLRLRSETGKRQHLWLAADSMDKAEWRDLRRLMMQPSTQG
VVLWQSDLRVSWRAQWLSLLLHGLVAAAILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINARQGEVKLLMDGRLRWQGQ
DWLIVSAPWMIKTGMMLRLRSETGKRQHLWLAADSMDKAEWRDLRRLMMQPSTQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q8D714 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F6TWP9 |