Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1332507..1333127 | Replicon | chromosome |
| Accession | NZ_CP096905 | ||
| Organism | Citrobacter amalonaticus strain RSHH22 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | M2R49_RS06335 | Protein ID | WP_001280991.1 |
| Coordinates | 1332507..1332725 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A3Q8DH98 |
| Locus tag | M2R49_RS06340 | Protein ID | WP_042324455.1 |
| Coordinates | 1332753..1333127 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2R49_RS06305 (M2R49_06300) | 1328160..1328756 | + | 597 | WP_054176084.1 | membrane protein | - |
| M2R49_RS06310 (M2R49_06305) | 1328839..1329192 | + | 354 | WP_043001561.1 | DUF1428 family protein | - |
| M2R49_RS06315 (M2R49_06310) | 1329232..1330782 | - | 1551 | WP_054176085.1 | EAL domain-containing protein | - |
| M2R49_RS06320 (M2R49_06315) | 1331005..1331145 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| M2R49_RS06325 (M2R49_06320) | 1331195..1331665 | - | 471 | WP_043001559.1 | YlaC family protein | - |
| M2R49_RS06330 (M2R49_06325) | 1331779..1332330 | - | 552 | WP_044258934.1 | maltose O-acetyltransferase | - |
| M2R49_RS06335 (M2R49_06330) | 1332507..1332725 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| M2R49_RS06340 (M2R49_06335) | 1332753..1333127 | - | 375 | WP_042324455.1 | Hha toxicity modulator TomB | Antitoxin |
| M2R49_RS06345 (M2R49_06340) | 1333639..1336788 | - | 3150 | WP_043001557.1 | efflux RND transporter permease AcrB | - |
| M2R49_RS06350 (M2R49_06345) | 1336811..1338004 | - | 1194 | WP_043001556.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T244129 WP_001280991.1 NZ_CP096905:c1332725-1332507 [Citrobacter amalonaticus]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14495.31 Da Isoelectric Point: 4.8989
>AT244129 WP_042324455.1 NZ_CP096905:c1333127-1332753 [Citrobacter amalonaticus]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|