Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3950743..3951541 Replicon chromosome
Accession NZ_CP096902
Organism Escherichia coli strain RSHH22

Toxin (Protein)


Gene name yeeV Uniprot ID Q8VRA6
Locus tag M1Y13_RS19530 Protein ID WP_000854730.1
Coordinates 3951164..3951541 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P0SQV8
Locus tag M1Y13_RS19525 Protein ID WP_001285481.1
Coordinates 3950743..3951117 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1Y13_RS19485 (3946718) 3946718..3947170 + 453 WP_000682723.1 hypothetical protein -
M1Y13_RS19490 (3947288) 3947288..3947521 + 234 WP_001213776.1 DUF905 family protein -
M1Y13_RS19495 (3947621) 3947621..3948442 + 822 WP_001234359.1 DUF932 domain-containing protein -
M1Y13_RS19500 (3948442) 3948442..3948687 + 246 WP_001164966.1 hypothetical protein -
M1Y13_RS19505 (3948781) 3948781..3949254 + 474 WP_001313575.1 antirestriction protein -
M1Y13_RS19510 (3949270) 3949270..3949746 + 477 WP_001313574.1 RadC family protein -
M1Y13_RS19515 (3949809) 3949809..3950030 + 222 WP_000692315.1 DUF987 domain-containing protein -
M1Y13_RS19520 (3950049) 3950049..3950693 + 645 WP_000086759.1 hypothetical protein -
M1Y13_RS19525 (3950743) 3950743..3951117 + 375 WP_001285481.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M1Y13_RS19530 (3951164) 3951164..3951541 + 378 WP_000854730.1 TA system toxin CbtA family protein Toxin
M1Y13_RS19535 (3951538) 3951538..3952030 + 493 Protein_3837 DUF5983 family protein -
M1Y13_RS19540 (3952109) 3952109..3953097 - 989 Protein_3838 IS630 family transposase -
M1Y13_RS19545 (3953269) 3953269..3954838 - 1570 Protein_3839 IS66 family transposase -
M1Y13_RS19550 (3954869) 3954869..3955219 - 351 WP_000624707.1 IS66 family insertion sequence element accessory protein TnpB -
M1Y13_RS19555 (3955216) 3955216..3955507 - 292 Protein_3841 transposase -
M1Y13_RS19560 (3955549) 3955549..3955743 + 195 WP_001313570.1 DUF957 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14212.21 Da        Isoelectric Point: 7.2923

>T244119 WP_000854730.1 NZ_CP096902:3951164-3951541 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13817.53 Da        Isoelectric Point: 4.7511

>AT244119 WP_001285481.1 NZ_CP096902:3950743-3951117 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V671

Antitoxin

Source ID Structure
AlphaFold DB A0A0P0SQV8

References