Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3874642..3875476 Replicon chromosome
Accession NZ_CP096902
Organism Escherichia coli strain RSHH22

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag M1Y13_RS19155 Protein ID WP_079399123.1
Coordinates 3874642..3875019 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag M1Y13_RS19160 Protein ID WP_129541717.1
Coordinates 3875108..3875476 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1Y13_RS19125 (3869900) 3869900..3870856 + 957 WP_000121356.1 molybdenum cofactor insertion chaperone PaoD -
M1Y13_RS19130 (3870907) 3870907..3871245 + 339 Protein_3756 LysR substrate-binding domain-containing protein -
M1Y13_RS19135 (3871583) 3871583..3872902 + 1320 WP_000144688.1 site-specific integrase -
M1Y13_RS19140 (3872995) 3872995..3873843 - 849 WP_129541718.1 DUF4942 domain-containing protein -
M1Y13_RS19145 (3873940) 3873940..3874137 - 198 WP_000772024.1 DUF957 domain-containing protein -
M1Y13_RS19150 (3874157) 3874157..3874645 - 489 WP_032215286.1 DUF5983 family protein -
M1Y13_RS19155 (3874642) 3874642..3875019 - 378 WP_079399123.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M1Y13_RS19160 (3875108) 3875108..3875476 - 369 WP_129541717.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M1Y13_RS19165 (3875556) 3875556..3875777 - 222 WP_129541716.1 DUF987 domain-containing protein -
M1Y13_RS19170 (3875840) 3875840..3876316 - 477 WP_001186726.1 RadC family protein -
M1Y13_RS19175 (3876332) 3876332..3876817 - 486 WP_000849574.1 antirestriction protein -
M1Y13_RS19180 (3876908) 3876908..3877690 - 783 WP_129541715.1 DUF932 domain-containing protein -
M1Y13_RS19185 (3877790) 3877790..3878023 - 234 WP_001119729.1 DUF905 family protein -
M1Y13_RS19190 (3878102) 3878102..3878557 - 456 WP_000581502.1 IrmA family protein -
M1Y13_RS19195 (3878633) 3878633..3880204 - 1572 Protein_3769 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 3834612..3881645 47033


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14158.21 Da        Isoelectric Point: 7.8523

>T244118 WP_079399123.1 NZ_CP096902:c3875019-3874642 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.55 Da        Isoelectric Point: 6.4652

>AT244118 WP_129541717.1 NZ_CP096902:c3875476-3875108 [Escherichia coli]
VSDTLPGTILPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFALLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References