Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3705831..3706668 | Replicon | chromosome |
Accession | NZ_CP096902 | ||
Organism | Escherichia coli strain RSHH22 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | M1Y13_RS18380 | Protein ID | WP_000227784.1 |
Coordinates | 3706126..3706668 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | M1Y13_RS18375 | Protein ID | WP_001297137.1 |
Coordinates | 3705831..3706142 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1Y13_RS18350 (3700851) | 3700851..3701798 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
M1Y13_RS18355 (3701820) | 3701820..3703811 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
M1Y13_RS18360 (3703801) | 3703801..3704415 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M1Y13_RS18365 (3704415) | 3704415..3704744 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M1Y13_RS18370 (3704756) | 3704756..3705646 | + | 891 | WP_000971336.1 | heme o synthase | - |
M1Y13_RS18375 (3705831) | 3705831..3706142 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
M1Y13_RS18380 (3706126) | 3706126..3706668 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
M1Y13_RS18385 (3706724) | 3706724..3707659 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
M1Y13_RS18390 (3708067) | 3708067..3709431 | + | 1365 | WP_001000978.1 | MFS transporter | - |
M1Y13_RS18395 (3709559) | 3709559..3710050 | - | 492 | WP_129541729.1 | nucleotide binding protein YajQ | - |
M1Y13_RS18400 (3710218) | 3710218..3711129 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T244117 WP_000227784.1 NZ_CP096902:3706126-3706668 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|