Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3671742..3672360 | Replicon | chromosome |
Accession | NZ_CP096902 | ||
Organism | Escherichia coli strain RSHH22 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M1Y13_RS18210 | Protein ID | WP_001291435.1 |
Coordinates | 3672142..3672360 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M1Y13_RS18205 | Protein ID | WP_000344800.1 |
Coordinates | 3671742..3672116 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1Y13_RS18195 (3666831) | 3666831..3668024 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M1Y13_RS18200 (3668047) | 3668047..3671196 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
M1Y13_RS18205 (3671742) | 3671742..3672116 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M1Y13_RS18210 (3672142) | 3672142..3672360 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M1Y13_RS18215 (3672532) | 3672532..3673083 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
M1Y13_RS18220 (3673199) | 3673199..3673669 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M1Y13_RS18225 (3673833) | 3673833..3675383 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M1Y13_RS18230 (3675425) | 3675425..3675778 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M1Y13_RS18240 (3676157) | 3676157..3676468 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M1Y13_RS18245 (3676499) | 3676499..3677071 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244116 WP_001291435.1 NZ_CP096902:3672142-3672360 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT244116 WP_000344800.1 NZ_CP096902:3671742-3672116 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |