Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1439352..1439977 | Replicon | chromosome |
Accession | NZ_CP096902 | ||
Organism | Escherichia coli strain RSHH22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M1Y13_RS07090 | Protein ID | WP_000911330.1 |
Coordinates | 1439579..1439977 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | M1Y13_RS07085 | Protein ID | WP_000450524.1 |
Coordinates | 1439352..1439579 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1Y13_RS07060 (1435155) | 1435155..1435625 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
M1Y13_RS07065 (1435625) | 1435625..1436197 | - | 573 | WP_000176191.1 | glycine cleavage system transcriptional repressor | - |
M1Y13_RS07070 (1436343) | 1436343..1437221 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
M1Y13_RS07075 (1437238) | 1437238..1438272 | + | 1035 | WP_001358397.1 | outer membrane protein assembly factor BamC | - |
M1Y13_RS07080 (1438485) | 1438485..1439198 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
M1Y13_RS07085 (1439352) | 1439352..1439579 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
M1Y13_RS07090 (1439579) | 1439579..1439977 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M1Y13_RS07095 (1440124) | 1440124..1440987 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
M1Y13_RS07100 (1441002) | 1441002..1443017 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
M1Y13_RS07105 (1443091) | 1443091..1443789 | + | 699 | WP_000679823.1 | esterase | - |
M1Y13_RS07110 (1443899) | 1443899..1444099 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T244094 WP_000911330.1 NZ_CP096902:1439579-1439977 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|