Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 791469..792304 | Replicon | chromosome |
| Accession | NZ_CP096902 | ||
| Organism | Escherichia coli strain RSHH22 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A085P7I8 |
| Locus tag | M1Y13_RS03825 | Protein ID | WP_001562089.1 |
| Coordinates | 791469..791846 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A085P7I7 |
| Locus tag | M1Y13_RS03830 | Protein ID | WP_001327592.1 |
| Coordinates | 791936..792304 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1Y13_RS03795 (786869) | 786869..787846 | + | 978 | WP_000633239.1 | type II secretion system minor pseudopilin GspK | - |
| M1Y13_RS03800 (787843) | 787843..789021 | + | 1179 | WP_000094989.1 | type II secretion system protein GspL | - |
| M1Y13_RS03805 (789023) | 789023..789559 | + | 537 | WP_000942795.1 | GspM family type II secretion system protein YghD | - |
| M1Y13_RS03810 (789840) | 789840..790682 | - | 843 | WP_001519083.1 | DUF4942 domain-containing protein | - |
| M1Y13_RS03815 (790767) | 790767..790964 | - | 198 | WP_000445282.1 | DUF957 domain-containing protein | - |
| M1Y13_RS03820 (790984) | 790984..791472 | - | 489 | Protein_749 | DUF5983 family protein | - |
| M1Y13_RS03825 (791469) | 791469..791846 | - | 378 | WP_001562089.1 | TA system toxin CbtA family protein | Toxin |
| M1Y13_RS03830 (791936) | 791936..792304 | - | 369 | WP_001327592.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M1Y13_RS03835 (792467) | 792467..792688 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| M1Y13_RS03840 (792757) | 792757..793233 | - | 477 | WP_001186724.1 | RadC family protein | - |
| M1Y13_RS03845 (793249) | 793249..793728 | - | 480 | WP_000706981.1 | antirestriction protein | - |
| M1Y13_RS03850 (794067) | 794067..794885 | - | 819 | WP_001234639.1 | DUF932 domain-containing protein | - |
| M1Y13_RS03855 (795169) | 795169..795624 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM | 705984..849945 | 143961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14345.29 Da Isoelectric Point: 9.1643
>T244091 WP_001562089.1 NZ_CP096902:c791846-791469 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPRF
STSPRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPRF
STSPRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13901.65 Da Isoelectric Point: 6.3165
>AT244091 WP_001327592.1 NZ_CP096902:c792304-791936 [Escherichia coli]
VSDTHHETNYPDDYNNRPWWGLPCTITPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTHHETNYPDDYNNRPWWGLPCTITPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085P7I8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085P7I7 |