Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3533234..3533887 | Replicon | chromosome |
| Accession | NZ_CP096894 | ||
| Organism | Acinetobacter baumannii strain Mu1956 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | M1783_RS17050 | Protein ID | WP_000607077.1 |
| Coordinates | 3533234..3533623 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | M1783_RS17055 | Protein ID | WP_001288210.1 |
| Coordinates | 3533630..3533887 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1783_RS17035 (M1783_17035) | 3528352..3530547 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
| M1783_RS17040 (M1783_17040) | 3530735..3531301 | - | 567 | WP_000651538.1 | rhombosortase | - |
| M1783_RS17045 (M1783_17045) | 3531379..3532464 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| M1783_RS17050 (M1783_17050) | 3533234..3533623 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
| M1783_RS17055 (M1783_17055) | 3533630..3533887 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| M1783_RS17060 (M1783_17060) | 3534075..3535247 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| M1783_RS17065 (M1783_17065) | 3535296..3536786 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| M1783_RS17070 (M1783_17070) | 3536968..3537345 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| M1783_RS17075 (M1783_17075) | 3537364..3538371 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T244086 WP_000607077.1 NZ_CP096894:c3533623-3533234 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|