Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1380428..1381344 | Replicon | chromosome |
Accession | NZ_CP096889 | ||
Organism | Bacillus cabrialesii strain TE3 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | EFK13_RS07175 | Protein ID | WP_129505965.1 |
Coordinates | 1380598..1381344 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | EFK13_RS07170 | Protein ID | WP_064813250.1 |
Coordinates | 1380428..1380598 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EFK13_RS07135 (EFK13_07135) | 1377299..1377628 | + | 330 | WP_129505969.1 | XkdW family protein | - |
EFK13_RS07140 (EFK13_07140) | 1377625..1377789 | + | 165 | WP_075745568.1 | XkdX family protein | - |
EFK13_RS07145 (EFK13_07145) | 1377834..1378676 | + | 843 | WP_129505968.1 | phage portal protein | - |
EFK13_RS07150 (EFK13_07150) | 1378726..1378995 | + | 270 | WP_119997125.1 | hemolysin XhlA family protein | - |
EFK13_RS07155 (EFK13_07155) | 1379008..1379271 | + | 264 | WP_129505967.1 | phage holin | - |
EFK13_RS07160 (EFK13_07160) | 1379284..1380177 | + | 894 | WP_129505966.1 | N-acetylmuramoyl-L-alanine amidase | - |
EFK13_RS07165 (EFK13_07165) | 1380205..1380342 | - | 138 | WP_119913750.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
EFK13_RS07170 (EFK13_07170) | 1380428..1380598 | - | 171 | WP_064813250.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
EFK13_RS07175 (EFK13_07175) | 1380598..1381344 | - | 747 | WP_129505965.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
EFK13_RS07180 (EFK13_07180) | 1381454..1382455 | - | 1002 | WP_129505964.1 | inorganic phosphate transporter | - |
EFK13_RS07185 (EFK13_07185) | 1382468..1383085 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
EFK13_RS07190 (EFK13_07190) | 1383362..1384678 | - | 1317 | WP_129505963.1 | serine/threonine exchanger | - |
EFK13_RS07195 (EFK13_07195) | 1385065..1386015 | + | 951 | WP_129505962.1 | ring-cleaving dioxygenase | - |
EFK13_RS07200 (EFK13_07200) | 1386093..1386239 | + | 147 | WP_129505961.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1347514..1386015 | 38501 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 28938.31 Da Isoelectric Point: 4.4393
>T244084 WP_129505965.1 NZ_CP096889:c1381344-1380598 [Bacillus cabrialesii]
MLLFFQIMVWCIMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYDPSSLFADWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSVDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQDGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCIMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYDPSSLFADWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSVDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQDGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|