Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 546948..547584 | Replicon | chromosome |
| Accession | NZ_CP096889 | ||
| Organism | Bacillus cabrialesii strain TE3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | EFK13_RS02800 | Protein ID | WP_003156187.1 |
| Coordinates | 547234..547584 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | EFK13_RS02795 | Protein ID | WP_003225183.1 |
| Coordinates | 546948..547229 (+) | Length | 94 a.a. |
Genomic Context
Location: 544002..544367 (366 bp)
Type: Others
Protein ID: WP_129506638.1
Type: Others
Protein ID: WP_129506638.1
Location: 544532..545548 (1017 bp)
Type: Others
Protein ID: WP_129506637.1
Type: Others
Protein ID: WP_129506637.1
Location: 545663..546832 (1170 bp)
Type: Others
Protein ID: WP_129506738.1
Type: Others
Protein ID: WP_129506738.1
Location: 546948..547229 (282 bp)
Type: Antitoxin
Protein ID: WP_003225183.1
Type: Antitoxin
Protein ID: WP_003225183.1
Location: 547234..547584 (351 bp)
Type: Toxin
Protein ID: WP_003156187.1
Type: Toxin
Protein ID: WP_003156187.1
Location: 547700..548524 (825 bp)
Type: Others
Protein ID: WP_129506636.1
Type: Others
Protein ID: WP_129506636.1
Location: 548529..548894 (366 bp)
Type: Others
Protein ID: WP_003225190.1
Type: Others
Protein ID: WP_003225190.1
Location: 548898..549299 (402 bp)
Type: Others
Protein ID: WP_014112733.1
Type: Others
Protein ID: WP_014112733.1
Location: 549311..550318 (1008 bp)
Type: Others
Protein ID: WP_129506635.1
Type: Others
Protein ID: WP_129506635.1
Location: 550380..550709 (330 bp)
Type: Others
Protein ID: WP_129506634.1
Type: Others
Protein ID: WP_129506634.1
Location: 550706..551188 (483 bp)
Type: Others
Protein ID: WP_003234299.1
Type: Others
Protein ID: WP_003234299.1
Location: 551154..551942 (789 bp)
Type: Others
Protein ID: WP_003225200.1
Type: Others
Protein ID: WP_003225200.1
Location: 551942..552541 (600 bp)
Type: Others
Protein ID: WP_129506633.1
Type: Others
Protein ID: WP_129506633.1
Location: 543308..543907 (600 bp)
Type: Others
Protein ID: WP_129506639.1
Type: Others
Protein ID: WP_129506639.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFK13_RS02775 (EFK13_02775) | 543308..543907 | - | 600 | WP_129506639.1 | rhomboid family intramembrane serine protease | - |
| EFK13_RS02780 (EFK13_02780) | 544002..544367 | + | 366 | WP_129506638.1 | holo-ACP synthase | - |
| EFK13_RS02785 (EFK13_02785) | 544532..545548 | + | 1017 | WP_129506637.1 | outer membrane lipoprotein carrier protein LolA | - |
| EFK13_RS02790 (EFK13_02790) | 545663..546832 | + | 1170 | WP_129506738.1 | alanine racemase | - |
| EFK13_RS02795 (EFK13_02795) | 546948..547229 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| EFK13_RS02800 (EFK13_02800) | 547234..547584 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| EFK13_RS02805 (EFK13_02805) | 547700..548524 | + | 825 | WP_129506636.1 | RsbT co-antagonist protein RsbRA | - |
| EFK13_RS02810 (EFK13_02810) | 548529..548894 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| EFK13_RS02815 (EFK13_02815) | 548898..549299 | + | 402 | WP_014112733.1 | serine/threonine-protein kinase RsbT | - |
| EFK13_RS02820 (EFK13_02820) | 549311..550318 | + | 1008 | WP_129506635.1 | phosphoserine phosphatase RsbU | - |
| EFK13_RS02825 (EFK13_02825) | 550380..550709 | + | 330 | WP_129506634.1 | anti-sigma factor antagonist RsbV | - |
| EFK13_RS02830 (EFK13_02830) | 550706..551188 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| EFK13_RS02835 (EFK13_02835) | 551154..551942 | + | 789 | WP_003225200.1 | RNA polymerase sigma factor SigB | - |
| EFK13_RS02840 (EFK13_02840) | 551942..552541 | + | 600 | WP_129506633.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T244083 WP_003156187.1 NZ_CP096889:547234-547584 [Bacillus cabrialesii]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp