Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 546948..547584 | Replicon | chromosome |
| Accession | NZ_CP096889 | ||
| Organism | Bacillus cabrialesii strain TE3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | EFK13_RS02800 | Protein ID | WP_003156187.1 |
| Coordinates | 547234..547584 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | EFK13_RS02795 | Protein ID | WP_003225183.1 |
| Coordinates | 546948..547229 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFK13_RS02775 (EFK13_02775) | 543308..543907 | - | 600 | WP_129506639.1 | rhomboid family intramembrane serine protease | - |
| EFK13_RS02780 (EFK13_02780) | 544002..544367 | + | 366 | WP_129506638.1 | holo-ACP synthase | - |
| EFK13_RS02785 (EFK13_02785) | 544532..545548 | + | 1017 | WP_129506637.1 | outer membrane lipoprotein carrier protein LolA | - |
| EFK13_RS02790 (EFK13_02790) | 545663..546832 | + | 1170 | WP_129506738.1 | alanine racemase | - |
| EFK13_RS02795 (EFK13_02795) | 546948..547229 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| EFK13_RS02800 (EFK13_02800) | 547234..547584 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| EFK13_RS02805 (EFK13_02805) | 547700..548524 | + | 825 | WP_129506636.1 | RsbT co-antagonist protein RsbRA | - |
| EFK13_RS02810 (EFK13_02810) | 548529..548894 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| EFK13_RS02815 (EFK13_02815) | 548898..549299 | + | 402 | WP_014112733.1 | serine/threonine-protein kinase RsbT | - |
| EFK13_RS02820 (EFK13_02820) | 549311..550318 | + | 1008 | WP_129506635.1 | phosphoserine phosphatase RsbU | - |
| EFK13_RS02825 (EFK13_02825) | 550380..550709 | + | 330 | WP_129506634.1 | anti-sigma factor antagonist RsbV | - |
| EFK13_RS02830 (EFK13_02830) | 550706..551188 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| EFK13_RS02835 (EFK13_02835) | 551154..551942 | + | 789 | WP_003225200.1 | RNA polymerase sigma factor SigB | - |
| EFK13_RS02840 (EFK13_02840) | 551942..552541 | + | 600 | WP_129506633.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T244083 WP_003156187.1 NZ_CP096889:547234-547584 [Bacillus cabrialesii]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|