Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 795692..796328 | Replicon | chromosome |
| Accession | NZ_CP096886 | ||
| Organism | Rossellomorea sp. KS-H15a | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A366ENG2 |
| Locus tag | M1J35_RS04010 | Protein ID | WP_034763063.1 |
| Coordinates | 795978..796328 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A0V8H6B8 |
| Locus tag | M1J35_RS04005 | Protein ID | WP_032085355.1 |
| Coordinates | 795692..795973 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1J35_RS03985 (M1J35_03985) | 791827..792411 | - | 585 | WP_254652794.1 | rhomboid family intramembrane serine protease | - |
| M1J35_RS03990 (M1J35_03990) | 792547..792897 | + | 351 | WP_254652795.1 | holo-ACP synthase | - |
| M1J35_RS03995 (M1J35_03995) | 793109..794122 | + | 1014 | WP_254652796.1 | outer membrane lipoprotein carrier protein LolA | - |
| M1J35_RS04000 (M1J35_04000) | 794360..795565 | + | 1206 | WP_254652797.1 | alanine racemase | - |
| M1J35_RS04005 (M1J35_04005) | 795692..795973 | + | 282 | WP_032085355.1 | YlcI/YnfO family protein | Antitoxin |
| M1J35_RS04010 (M1J35_04010) | 795978..796328 | + | 351 | WP_034763063.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| M1J35_RS22665 | 796325..796459 | - | 135 | WP_256503952.1 | hypothetical protein | - |
| M1J35_RS04015 (M1J35_04015) | 796734..797564 | + | 831 | WP_224521611.1 | RsbT co-antagonist protein RsbRA | - |
| M1J35_RS04020 (M1J35_04020) | 797555..797917 | + | 363 | WP_152968625.1 | STAS domain-containing protein | - |
| M1J35_RS04025 (M1J35_04025) | 797920..798321 | + | 402 | WP_034763056.1 | anti-sigma regulatory factor | - |
| M1J35_RS04030 (M1J35_04030) | 798332..799342 | + | 1011 | WP_224521610.1 | PP2C family protein-serine/threonine phosphatase | - |
| M1J35_RS04035 (M1J35_04035) | 799417..799749 | + | 333 | WP_224521609.1 | anti-sigma factor antagonist | - |
| M1J35_RS04040 (M1J35_04040) | 799746..800216 | + | 471 | WP_079532947.1 | anti-sigma B factor RsbW | - |
| M1J35_RS04045 (M1J35_04045) | 800194..800991 | + | 798 | WP_224521608.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13005.05 Da Isoelectric Point: 5.1554
>T244082 WP_034763063.1 NZ_CP096886:795978-796328 [Rossellomorea sp. KS-H15a]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTIIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDDALQISVGLIQF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTIIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDDALQISVGLIQF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366ENG2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V8H6B8 |