Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-PHD |
| Location | 3771771..3772456 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TIR9 |
| Locus tag | M1778_RS17700 | Protein ID | WP_003417998.1 |
| Coordinates | 3772046..3772456 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M1778_RS17695 | Protein ID | WP_003912220.1 |
| Coordinates | 3771771..3772049 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS17675 (M1778_17670) | 3767760..3769361 | - | 1602 | WP_003417969.1 | FAD/NAD(P)-binding protein | - |
| M1778_RS17680 (M1778_17675) | 3769378..3770082 | - | 705 | WP_003417980.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
| M1778_RS17685 (M1778_17680) | 3770200..3770766 | - | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
| M1778_RS17690 (M1778_17685) | 3770828..3771715 | + | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
| M1778_RS17695 (M1778_17690) | 3771771..3772049 | + | 279 | WP_003912220.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M1778_RS17700 (M1778_17695) | 3772046..3772456 | + | 411 | WP_003417998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1778_RS17705 (M1778_17700) | 3772489..3774225 | - | 1737 | WP_003418002.1 | cholesterol oxidase | - |
| M1778_RS17710 (M1778_17705) | 3774281..3775408 | - | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
| M1778_RS17715 (M1778_17710) | 3775428..3777017 | - | 1590 | WP_003900682.1 | IMP dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14695.84 Da Isoelectric Point: 5.1784
>T244079 WP_003417998.1 NZ_CP096848:3772046-3772456 [Mycobacterium tuberculosis variant bovis]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|