Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Txe-YefM |
| Location | 3717152..3717681 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TI95 |
| Locus tag | M1778_RS17455 | Protein ID | WP_003417760.1 |
| Coordinates | 3717424..3717681 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0TI94 |
| Locus tag | M1778_RS17450 | Protein ID | WP_003417757.1 |
| Coordinates | 3717152..3717427 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS17415 (M1778_17410) | 3713725..3714414 | - | 690 | WP_003917774.1 | BBE domain-containing protein | - |
| M1778_RS17420 (M1778_17415) | 3714601..3714972 | - | 372 | WP_003417739.1 | FAD-binding protein | - |
| M1778_RS17425 (M1778_17420) | 3714870..3715088 | - | 219 | WP_157132559.1 | hypothetical protein | - |
| M1778_RS17430 (M1778_17425) | 3715115..3715375 | - | 261 | WP_003417741.1 | hypothetical protein | - |
| M1778_RS17435 (M1778_17430) | 3715490..3715879 | + | 390 | WP_010950876.1 | DUF732 domain-containing protein | - |
| M1778_RS17440 (M1778_17435) | 3715893..3716186 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
| M1778_RS17445 (M1778_17440) | 3716183..3717028 | - | 846 | WP_010950877.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
| M1778_RS17450 (M1778_17445) | 3717152..3717427 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
| M1778_RS17455 (M1778_17450) | 3717424..3717681 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
| M1778_RS17460 (M1778_17455) | 3717723..3718913 | + | 1191 | WP_003900033.1 | NADH:flavin oxidoreductase | - |
| M1778_RS17465 (M1778_17460) | 3719030..3719398 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
| M1778_RS17470 (M1778_17465) | 3719395..3719946 | - | 552 | WP_003417767.1 | pentapeptide repeat protein MfpA | - |
| M1778_RS17475 (M1778_17470) | 3719953..3720534 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
| M1778_RS17480 (M1778_17475) | 3720515..3720883 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
| M1778_RS17485 (M1778_17480) | 3720861..3721253 | - | 393 | WP_003417776.1 | serine protease inhibitor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T244077 WP_003417760.1 NZ_CP096848:3717424-3717681 [Mycobacterium tuberculosis variant bovis]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|