Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3655187..3655861 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag M1778_RS17245 Protein ID WP_003417282.1
Coordinates 3655187..3655615 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag M1778_RS17250 Protein ID WP_003417286.1
Coordinates 3655619..3655861 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS17220 (M1778_17215) 3651009..3651410 - 402 WP_003417264.1 cytidine deaminase -
M1778_RS17225 (M1778_17220) 3651647..3651985 + 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
M1778_RS17230 (M1778_17225) 3651982..3652416 + 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
M1778_RS17235 (M1778_17230) 3652545..3654317 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
M1778_RS17240 (M1778_17235) 3654317..3655108 + 792 WP_010950870.1 succinate dehydrogenase iron-sulfur subunit -
M1778_RS17245 (M1778_17240) 3655187..3655615 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
M1778_RS17250 (M1778_17245) 3655619..3655861 - 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
M1778_RS17255 (M1778_17250) 3655983..3656597 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
M1778_RS17260 (M1778_17255) 3656594..3657259 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
M1778_RS17265 (M1778_17260) 3657260..3657793 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
M1778_RS17270 (M1778_17265) 3657790..3658164 - 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
M1778_RS17275 (M1778_17270) 3658261..3659265 - 1005 WP_003914475.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T244076 WP_003417282.1 NZ_CP096848:c3655615-3655187 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT244076 WP_003417286.1 NZ_CP096848:c3655861-3655619 [Mycobacterium tuberculosis variant bovis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References