Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3655187..3655861 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF52 |
| Locus tag | M1778_RS17245 | Protein ID | WP_003417282.1 |
| Coordinates | 3655187..3655615 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TI59 |
| Locus tag | M1778_RS17250 | Protein ID | WP_003417286.1 |
| Coordinates | 3655619..3655861 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS17220 (M1778_17215) | 3651009..3651410 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
| M1778_RS17225 (M1778_17220) | 3651647..3651985 | + | 339 | WP_003417267.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
| M1778_RS17230 (M1778_17225) | 3651982..3652416 | + | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
| M1778_RS17235 (M1778_17230) | 3652545..3654317 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
| M1778_RS17240 (M1778_17235) | 3654317..3655108 | + | 792 | WP_010950870.1 | succinate dehydrogenase iron-sulfur subunit | - |
| M1778_RS17245 (M1778_17240) | 3655187..3655615 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1778_RS17250 (M1778_17245) | 3655619..3655861 | - | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
| M1778_RS17255 (M1778_17250) | 3655983..3656597 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
| M1778_RS17260 (M1778_17255) | 3656594..3657259 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
| M1778_RS17265 (M1778_17260) | 3657260..3657793 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
| M1778_RS17270 (M1778_17265) | 3657790..3658164 | - | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
| M1778_RS17275 (M1778_17270) | 3658261..3659265 | - | 1005 | WP_003914475.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T244076 WP_003417282.1 NZ_CP096848:c3655615-3655187 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBL0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TI59 |