Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3085101..3085705 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag M1778_RS14660 Protein ID WP_003414492.1
Coordinates 3085101..3085493 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag M1778_RS14665 Protein ID WP_003414495.1
Coordinates 3085490..3085705 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS14630 (M1778_14630) 3080251..3081039 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
M1778_RS14635 (M1778_14635) 3081373..3081918 - 546 WP_003904931.1 DUF1802 family protein -
M1778_RS14640 (M1778_14640) 3082190..3083074 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M1778_RS14645 (M1778_14645) 3083077..3083964 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
M1778_RS14650 (M1778_14650) 3084269..3084814 - 546 WP_003899500.1 DUF1802 family protein -
M1778_RS14655 (M1778_14655) 3084811..3085080 - 270 WP_003414489.1 DUF2277 family protein -
M1778_RS14660 (M1778_14660) 3085101..3085493 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
M1778_RS14665 (M1778_14665) 3085490..3085705 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M1778_RS14670 (M1778_14670) 3085752..3086501 + 750 WP_003414497.1 enoyl-CoA hydratase -
M1778_RS14675 (M1778_14675) 3086580..3087662 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
M1778_RS14680 (M1778_14680) 3087655..3088965 - 1311 WP_031702645.1 ABC transporter substrate-binding protein -
M1778_RS14685 (M1778_14685) 3088968..3089795 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
M1778_RS14690 (M1778_14690) 3089792..3090703 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T244072 WP_003414492.1 NZ_CP096848:c3085493-3085101 [Mycobacterium tuberculosis variant bovis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT244072 WP_003414495.1 NZ_CP096848:c3085705-3085490 [Mycobacterium tuberculosis variant bovis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References