Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3058768..3059338 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | M1778_RS14515 | Protein ID | WP_003414166.1 |
| Coordinates | 3058768..3059124 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | M1778_RS14520 | Protein ID | WP_003901465.1 |
| Coordinates | 3059108..3059338 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS14495 (M1778_14495) | 3054220..3055908 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
| M1778_RS14500 (M1778_14500) | 3055912..3056238 | - | 327 | WP_003414157.1 | hypothetical protein | - |
| M1778_RS14505 (M1778_14505) | 3056411..3056998 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
| M1778_RS14510 (M1778_14510) | 3057017..3058666 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
| M1778_RS14515 (M1778_14515) | 3058768..3059124 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| M1778_RS14520 (M1778_14520) | 3059108..3059338 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
| M1778_RS14525 (M1778_14525) | 3059381..3060424 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| M1778_RS14530 (M1778_14530) | 3060423..3060890 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
| M1778_RS14535 (M1778_14535) | 3061066..3061320 | - | 255 | WP_003917684.1 | hypothetical protein | - |
| M1778_RS14540 (M1778_14540) | 3061468..3061872 | + | 405 | WP_003414181.1 | hypothetical protein | - |
| M1778_RS14545 (M1778_14545) | 3061869..3062060 | + | 192 | WP_003414184.1 | hypothetical protein | - |
| M1778_RS14550 (M1778_14550) | 3062277..3062537 | + | 261 | Protein_2871 | transposase | - |
| M1778_RS14555 (M1778_14555) | 3063647..3063904 | + | 258 | WP_003899489.1 | hypothetical protein | - |
| M1778_RS14560 (M1778_14560) | 3064009..3064320 | + | 312 | WP_010950777.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T244070 WP_003414166.1 NZ_CP096848:c3059124-3058768 [Mycobacterium tuberculosis variant bovis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|