Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2889607..2890321 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag M1778_RS13535 Protein ID WP_003413460.1
Coordinates 2889881..2890321 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag M1778_RS13530 Protein ID WP_003413456.1
Coordinates 2889607..2889894 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS13495 (M1778_13490) 2885030..2885275 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
M1778_RS13500 (M1778_13495) 2885272..2885676 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
M1778_RS13505 (M1778_13500) 2885893..2886513 + 621 WP_003413441.1 DUF4178 domain-containing protein -
M1778_RS13510 (M1778_13505) 2886524..2887018 + 495 WP_003413444.1 DUF2617 family protein -
M1778_RS13515 (M1778_13510) 2887015..2887445 + 431 Protein_2668 DUF4247 domain-containing protein -
M1778_RS13520 (M1778_13515) 2887470..2887928 + 459 WP_003413451.1 DUF350 domain-containing protein -
M1778_RS13525 (M1778_13520) 2887925..2889496 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
M1778_RS13530 (M1778_13525) 2889607..2889894 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
M1778_RS13535 (M1778_13530) 2889881..2890321 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
M1778_RS13540 (M1778_13535) 2890342..2891097 - 756 WP_079367662.1 YebC/PmpR family DNA-binding transcriptional regulator -
M1778_RS13545 (M1778_13540) 2891230..2891826 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
M1778_RS13550 (M1778_13545) 2891834..2892679 - 846 WP_010950749.1 acyl-CoA thioesterase II -
M1778_RS13555 (M1778_13550) 2892708..2893607 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
M1778_RS13560 (M1778_13555) 2893735..2894409 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T244067 WP_003413460.1 NZ_CP096848:2889881-2890321 [Mycobacterium tuberculosis variant bovis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT244067 WP_003413456.1 NZ_CP096848:2889607-2889894 [Mycobacterium tuberculosis variant bovis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References