Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2828167..2828798 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag M1778_RS13260 Protein ID WP_003413174.1
Coordinates 2828421..2828798 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag M1778_RS13255 Protein ID WP_003413167.1
Coordinates 2828167..2828424 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS13220 (M1778_13215) 2823425..2823739 + 315 WP_009937839.1 hypothetical protein -
M1778_RS13225 (M1778_13220) 2824035..2825246 + 1212 WP_079367713.1 alpha/beta hydrolase family protein -
M1778_RS13230 (M1778_13225) 2825373..2826032 + 660 WP_003900846.1 LppA family lipoprotein -
M1778_RS13235 (M1778_13230) 2826029..2826688 + 660 WP_003900847.1 LppA family lipoprotein -
M1778_RS13240 (M1778_13235) 2826685..2827347 + 663 WP_003900848.1 LppA family lipoprotein -
M1778_RS13245 (M1778_13240) 2827344..2827622 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
M1778_RS13250 (M1778_13245) 2827715..2828128 + 414 WP_003413164.1 PIN domain nuclease -
M1778_RS13255 (M1778_13250) 2828167..2828424 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
M1778_RS13260 (M1778_13255) 2828421..2828798 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
M1778_RS13265 (M1778_13260) 2828814..2829188 - 375 WP_003413177.1 hypothetical protein -
M1778_RS13270 (M1778_13265) 2829288..2829683 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
M1778_RS13275 (M1778_13270) 2829680..2829925 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
M1778_RS13280 (M1778_13275) 2830336..2830755 - 420 WP_003413190.1 A24 family peptidase -
M1778_RS13285 (M1778_13280) 2830767..2831575 - 809 Protein_2622 shikimate dehydrogenase -
M1778_RS13290 (M1778_13285) 2831572..2832825 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
M1778_RS13295 (M1778_13290) 2832818..2833330 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T244065 WP_003413174.1 NZ_CP096848:2828421-2828798 [Mycobacterium tuberculosis variant bovis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT244065 WP_003413167.1 NZ_CP096848:2828167-2828424 [Mycobacterium tuberculosis variant bovis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References