Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 2827715..2828424 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ26 |
| Locus tag | M1778_RS13250 | Protein ID | WP_003413164.1 |
| Coordinates | 2827715..2828128 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | M1778_RS13255 | Protein ID | WP_003413167.1 |
| Coordinates | 2828167..2828424 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS13220 (M1778_13215) | 2823425..2823739 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| M1778_RS13225 (M1778_13220) | 2824035..2825246 | + | 1212 | WP_079367713.1 | alpha/beta hydrolase family protein | - |
| M1778_RS13230 (M1778_13225) | 2825373..2826032 | + | 660 | WP_003900846.1 | LppA family lipoprotein | - |
| M1778_RS13235 (M1778_13230) | 2826029..2826688 | + | 660 | WP_003900847.1 | LppA family lipoprotein | - |
| M1778_RS13240 (M1778_13235) | 2826685..2827347 | + | 663 | WP_003900848.1 | LppA family lipoprotein | - |
| M1778_RS13245 (M1778_13240) | 2827344..2827622 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M1778_RS13250 (M1778_13245) | 2827715..2828128 | + | 414 | WP_003413164.1 | PIN domain nuclease | Toxin |
| M1778_RS13255 (M1778_13250) | 2828167..2828424 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
| M1778_RS13260 (M1778_13255) | 2828421..2828798 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
| M1778_RS13265 (M1778_13260) | 2828814..2829188 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| M1778_RS13270 (M1778_13265) | 2829288..2829683 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| M1778_RS13275 (M1778_13270) | 2829680..2829925 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| M1778_RS13280 (M1778_13275) | 2830336..2830755 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| M1778_RS13285 (M1778_13280) | 2830767..2831575 | - | 809 | Protein_2622 | shikimate dehydrogenase | - |
| M1778_RS13290 (M1778_13285) | 2831572..2832825 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| M1778_RS13295 (M1778_13290) | 2832818..2833330 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15045.00 Da Isoelectric Point: 5.4673
>T244064 WP_003413164.1 NZ_CP096848:2827715-2828128 [Mycobacterium tuberculosis variant bovis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ26 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |