Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2813172..2813812 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ08 |
| Locus tag | M1778_RS13160 | Protein ID | WP_003412970.1 |
| Coordinates | 2813172..2813591 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ09 |
| Locus tag | M1778_RS13165 | Protein ID | WP_003412975.1 |
| Coordinates | 2813588..2813812 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS13130 (M1778_13125) | 2808757..2809479 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
| M1778_RS13135 (M1778_13130) | 2809996..2810223 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M1778_RS13140 (M1778_13135) | 2810220..2810621 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
| M1778_RS13145 (M1778_13140) | 2810656..2811576 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
| M1778_RS13150 (M1778_13145) | 2811917..2812123 | - | 207 | WP_234712436.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| M1778_RS13155 (M1778_13150) | 2812221..2813171 | + | 951 | WP_165689263.1 | ERCC4 domain-containing protein | - |
| M1778_RS13160 (M1778_13155) | 2813172..2813591 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1778_RS13165 (M1778_13160) | 2813588..2813812 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
| M1778_RS13170 (M1778_13165) | 2813843..2816686 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| M1778_RS13175 (M1778_13170) | 2816758..2817159 | - | 402 | WP_003412981.1 | hypothetical protein | - |
| M1778_RS13180 (M1778_13175) | 2817159..2817629 | - | 471 | WP_003412985.1 | transcription antitermination factor NusB | - |
| M1778_RS13185 (M1778_13180) | 2817632..2818195 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T244063 WP_003412970.1 NZ_CP096848:c2813591-2813172 [Mycobacterium tuberculosis variant bovis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|