Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2337986..2338681 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O53501 |
| Locus tag | M1778_RS10905 | Protein ID | WP_003410811.1 |
| Coordinates | 2337986..2338420 (-) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TMN0 |
| Locus tag | M1778_RS10910 | Protein ID | WP_003410814.1 |
| Coordinates | 2338427..2338681 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS10895 (M1778_10895) | 2334140..2337181 | + | 3042 | WP_010950658.1 | DEAD/DEAH box helicase | - |
| M1778_RS10900 (M1778_10900) | 2337174..2338007 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
| M1778_RS10905 (M1778_10905) | 2337986..2338420 | - | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1778_RS10910 (M1778_10910) | 2338427..2338681 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
| M1778_RS10915 (M1778_10915) | 2338697..2338954 | - | 258 | WP_003410816.1 | hypothetical protein | - |
| M1778_RS10920 (M1778_10920) | 2339901..2340197 | + | 297 | WP_003410820.1 | PE family protein | - |
| M1778_RS10925 (M1778_10925) | 2340253..2340984 | + | 732 | WP_003900467.1 | PPE family protein | - |
| M1778_RS10930 (M1778_10930) | 2341524..2342270 | - | 747 | WP_003901330.1 | proteasome subunit alpha | - |
| M1778_RS10935 (M1778_10935) | 2342267..2343142 | - | 876 | WP_003411023.1 | proteasome subunit beta | - |
| M1778_RS10940 (M1778_10940) | 2343139..2343333 | - | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T244060 WP_003410811.1 NZ_CP096848:c2338420-2337986 [Mycobacterium tuberculosis variant bovis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FB09 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMN0 |