Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2203924..2204510 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLY3 |
| Locus tag | M1778_RS10315 | Protein ID | WP_003410010.1 |
| Coordinates | 2203924..2204268 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL58 |
| Locus tag | M1778_RS10320 | Protein ID | WP_003410014.1 |
| Coordinates | 2204262..2204510 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS10280 (M1778_10280) | 2199630..2200229 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
| M1778_RS10285 (M1778_10285) | 2200645..2201073 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
| M1778_RS10290 (M1778_10290) | 2201299..2201838 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
| M1778_RS10295 (M1778_10295) | 2202358..2202918 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
| M1778_RS10300 (M1778_10300) | 2202915..2203256 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
| M1778_RS10305 (M1778_10305) | 2203342..2203599 | + | 258 | WP_003410006.1 | hypothetical protein | - |
| M1778_RS10310 (M1778_10310) | 2203500..2203835 | - | 336 | WP_003410009.1 | dehydrogenase | - |
| M1778_RS10315 (M1778_10315) | 2203924..2204268 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
| M1778_RS10320 (M1778_10320) | 2204262..2204510 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| M1778_RS10325 (M1778_10325) | 2204610..2206925 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
| M1778_RS10330 (M1778_10330) | 2206922..2207194 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
| M1778_RS10335 (M1778_10335) | 2207247..2207603 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
| M1778_RS10340 (M1778_10340) | 2207760..2208527 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T244056 WP_003410010.1 NZ_CP096848:c2204268-2203924 [Mycobacterium tuberculosis variant bovis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|