Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2186018..2186562 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag M1778_RS10190 Protein ID WP_003409896.1
Coordinates 2186018..2186314 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag M1778_RS10195 Protein ID WP_003409899.1
Coordinates 2186311..2186562 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS10135 (M1778_10135) 2181051..2181401 - 351 WP_003409871.1 hypothetical protein -
M1778_RS10140 (M1778_10140) 2181412..2182314 - 903 WP_003409874.1 hypothetical protein -
M1778_RS10145 (M1778_10145) 2182335..2182526 - 192 WP_003409876.1 hypothetical protein -
M1778_RS10150 (M1778_10150) 2182527..2182823 - 297 WP_003409877.1 hypothetical protein -
M1778_RS10155 (M1778_10155) 2183063..2183278 + 216 WP_003409878.1 antitoxin -
M1778_RS10160 (M1778_10160) 2183275..2183586 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
M1778_RS10165 (M1778_10165) 2183560..2184081 - 522 WP_010950637.1 hypothetical protein -
M1778_RS10170 (M1778_10170) 2184056..2184433 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
M1778_RS10175 (M1778_10175) 2184475..2184924 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
M1778_RS10180 (M1778_10180) 2184921..2185466 + 546 WP_003409891.1 SecB-like chaperone -
M1778_RS10185 (M1778_10185) 2185355..2185969 - 615 WP_003901296.1 hypothetical protein -
M1778_RS10190 (M1778_10190) 2186018..2186314 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M1778_RS10195 (M1778_10195) 2186311..2186562 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
M1778_RS10200 (M1778_10200) 2186549..2187043 + 495 WP_003899099.1 hypothetical protein -
M1778_RS10205 (M1778_10205) 2187203..2187610 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
M1778_RS10210 (M1778_10210) 2187614..2187886 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
M1778_RS10215 (M1778_10215) 2187919..2189139 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
M1778_RS10220 (M1778_10220) 2190038..2190343 + 306 Protein_2019 ABC transporter permease -
M1778_RS10225 (M1778_10225) 2190339..2190419 + 81 Protein_2020 hypothetical protein -
M1778_RS10230 (M1778_10230) 2190527..2191375 + 849 WP_003409942.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T244053 WP_003409896.1 NZ_CP096848:c2186314-2186018 [Mycobacterium tuberculosis variant bovis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT244053 WP_003409899.1 NZ_CP096848:c2186562-2186311 [Mycobacterium tuberculosis variant bovis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References