Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 1391842..1392401 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0THS1 |
| Locus tag | M1778_RS06665 | Protein ID | WP_003898789.1 |
| Coordinates | 1391842..1392135 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0THS2 |
| Locus tag | M1778_RS06670 | Protein ID | WP_003406322.1 |
| Coordinates | 1392132..1392401 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS06640 (M1778_06635) | 1387436..1387696 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
| M1778_RS06645 (M1778_06640) | 1387693..1388124 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
| M1778_RS06650 (M1778_06645) | 1388147..1389834 | - | 1688 | Protein_1312 | PE family protein | - |
| M1778_RS06655 (M1778_06650) | 1390014..1390874 | + | 861 | WP_003406306.1 | glycine betaine ABC transporter substrate-binding protein | - |
| M1778_RS06660 (M1778_06655) | 1390955..1391785 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| M1778_RS06665 (M1778_06660) | 1391842..1392135 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M1778_RS06670 (M1778_06665) | 1392132..1392401 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M1778_RS06675 (M1778_06670) | 1392514..1396209 | - | 3696 | WP_010950509.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
| M1778_RS06680 (M1778_06675) | 1396351..1397139 | - | 789 | WP_010950510.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T244044 WP_003898789.1 NZ_CP096848:c1392135-1391842 [Mycobacterium tuberculosis variant bovis]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|