Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1387436..1388124 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0THR7 |
| Locus tag | M1778_RS06645 | Protein ID | WP_003406304.1 |
| Coordinates | 1387693..1388124 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0THR6 |
| Locus tag | M1778_RS06640 | Protein ID | WP_003406302.1 |
| Coordinates | 1387436..1387696 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS06620 (M1778_06615) | 1383013..1383837 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
| M1778_RS06625 (M1778_06620) | 1383842..1385023 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
| M1778_RS06630 (M1778_06625) | 1385100..1386200 | - | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
| M1778_RS06635 (M1778_06630) | 1386371..1387360 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
| M1778_RS06640 (M1778_06635) | 1387436..1387696 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
| M1778_RS06645 (M1778_06640) | 1387693..1388124 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1778_RS06650 (M1778_06645) | 1388147..1389834 | - | 1688 | Protein_1312 | PE family protein | - |
| M1778_RS06655 (M1778_06650) | 1390014..1390874 | + | 861 | WP_003406306.1 | glycine betaine ABC transporter substrate-binding protein | - |
| M1778_RS06660 (M1778_06655) | 1390955..1391785 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| M1778_RS06665 (M1778_06660) | 1391842..1392135 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
| M1778_RS06670 (M1778_06665) | 1392132..1392401 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T244043 WP_003406304.1 NZ_CP096848:1387693-1388124 [Mycobacterium tuberculosis variant bovis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|