Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1242622..1243190 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag M1778_RS05970 Protein ID WP_003405865.1
Coordinates 1242816..1243190 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag M1778_RS05965 Protein ID WP_003405863.1
Coordinates 1242622..1242819 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS05945 (M1778_05945) 1238663..1239301 - 639 WP_003898730.1 lipid droplet-associated protein -
M1778_RS05950 (M1778_05950) 1239391..1240398 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
M1778_RS05955 (M1778_05955) 1240415..1241398 - 984 WP_003898731.1 hypothetical protein -
M1778_RS05960 (M1778_05960) 1241461..1242534 + 1074 WP_003405860.1 redox-regulated ATPase YchF -
M1778_RS05965 (M1778_05965) 1242622..1242819 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M1778_RS05970 (M1778_05970) 1242816..1243190 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
M1778_RS05975 (M1778_05975) 1243393..1244091 + 699 WP_010950494.1 hypothetical protein -
M1778_RS05980 (M1778_05980) 1244209..1244394 + 186 WP_003901093.1 hypothetical protein -
M1778_RS05985 (M1778_05985) 1244321..1244596 - 276 WP_003405867.1 hypothetical protein -
M1778_RS05990 (M1778_05990) 1244839..1245162 + 324 WP_003405871.1 putative quinol monooxygenase -
M1778_RS05995 (M1778_05995) 1245177..1245875 - 699 WP_031646953.1 hypothetical protein -
M1778_RS06000 (M1778_06000) 1245909..1246118 + 210 WP_003911400.1 hypothetical protein -
M1778_RS06005 (M1778_06005) 1246070..1246840 - 771 Protein_1183 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T244042 WP_003405865.1 NZ_CP096848:1242816-1243190 [Mycobacterium tuberculosis variant bovis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT244042 WP_003405863.1 NZ_CP096848:1242622-1242819 [Mycobacterium tuberculosis variant bovis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References