Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 758245..758933 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFB2 |
| Locus tag | M1778_RS03515 | Protein ID | WP_003403386.1 |
| Coordinates | 758245..758682 (-) | Length | 146 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | O06777 |
| Locus tag | M1778_RS03520 | Protein ID | WP_003911263.1 |
| Coordinates | 758679..758933 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS03485 (M1778_03485) | 754496..755506 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
| M1778_RS03490 (M1778_03490) | 755894..756277 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
| M1778_RS03495 (M1778_03495) | 756372..756527 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M1778_RS03500 (M1778_03500) | 756603..757319 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
| M1778_RS03505 (M1778_03505) | 757595..757903 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M1778_RS03510 (M1778_03510) | 757890..758135 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
| M1778_RS03515 (M1778_03515) | 758245..758682 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1778_RS03520 (M1778_03520) | 758679..758933 | - | 255 | WP_003911263.1 | antitoxin VapB7 | Antitoxin |
| M1778_RS03525 (M1778_03525) | 759047..761410 | + | 2364 | WP_003403397.1 | arylsulfatase AtsD | - |
| M1778_RS03530 (M1778_03530) | 761473..761799 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| M1778_RS03535 (M1778_03535) | 761711..762049 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
| M1778_RS03540 (M1778_03540) | 762046..762219 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T244036 WP_003403386.1 NZ_CP096848:c758682-758245 [Mycobacterium tuberculosis variant bovis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSW5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A806JQG1 |