Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 755894..756527 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag M1778_RS03490 Protein ID WP_003403365.1
Coordinates 755894..756277 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag M1778_RS03495 Protein ID WP_003403368.1
Coordinates 756372..756527 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS03465 (M1778_03465) 751186..751722 + 537 WP_003403341.1 50S ribosomal protein L10 -
M1778_RS03470 (M1778_03470) 751759..752151 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
M1778_RS03475 (M1778_03475) 752144..752839 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
M1778_RS03480 (M1778_03480) 752910..754415 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
M1778_RS03485 (M1778_03485) 754496..755506 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
M1778_RS03490 (M1778_03490) 755894..756277 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
M1778_RS03495 (M1778_03495) 756372..756527 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M1778_RS03500 (M1778_03500) 756603..757319 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
M1778_RS03505 (M1778_03505) 757595..757903 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
M1778_RS03510 (M1778_03510) 757890..758135 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
M1778_RS03515 (M1778_03515) 758245..758682 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
M1778_RS03520 (M1778_03520) 758679..758933 - 255 WP_003911263.1 antitoxin VapB7 -
M1778_RS03525 (M1778_03525) 759047..761410 + 2364 WP_003403397.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T244033 WP_003403365.1 NZ_CP096848:c756277-755894 [Mycobacterium tuberculosis variant bovis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT244033 WP_003403368.1 NZ_CP096848:c756527-756372 [Mycobacterium tuberculosis variant bovis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References