Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 718797..719446 | Replicon | chromosome |
Accession | NZ_CP096848 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | M1778_RS03305 | Protein ID | WP_003403236.1 |
Coordinates | 719051..719446 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | M1778_RS03300 | Protein ID | WP_003403235.1 |
Coordinates | 718797..719051 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1778_RS03275 (M1778_03275) | 713922..714005 | + | 84 | Protein_649 | galactose-1-phosphate uridylyltransferase | - |
M1778_RS03280 (M1778_03280) | 714024..715106 | + | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
M1778_RS03285 (M1778_03285) | 715103..716194 | + | 1092 | WP_003403225.1 | galactokinase | - |
M1778_RS03290 (M1778_03290) | 716589..717746 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
M1778_RS03295 (M1778_03295) | 717757..718704 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
M1778_RS03300 (M1778_03300) | 718797..719051 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
M1778_RS03305 (M1778_03305) | 719051..719446 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
M1778_RS03310 (M1778_03310) | 719540..720280 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
M1778_RS03315 (M1778_03315) | 720412..720672 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
M1778_RS03320 (M1778_03320) | 720669..721076 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
M1778_RS03325 (M1778_03325) | 721148..722299 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
M1778_RS03330 (M1778_03330) | 722392..724119 | - | 1728 | WP_010950423.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T244031 WP_003403236.1 NZ_CP096848:719051-719446 [Mycobacterium tuberculosis variant bovis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC2 |