Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 713168..713793 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | M1778_RS03270 | Protein ID | WP_003403218.1 |
| Coordinates | 713392..713793 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | M1778_RS03265 | Protein ID | WP_003403213.1 |
| Coordinates | 713168..713395 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS03240 (M1778_03240) | 708347..708568 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| M1778_RS03245 (M1778_03245) | 708710..709315 | + | 606 | WP_003898526.1 | hypothetical protein | - |
| M1778_RS03250 (M1778_03250) | 709334..711901 | - | 2568 | WP_079367682.1 | SEC-C metal-binding domain-containing protein | - |
| M1778_RS03255 (M1778_03255) | 711985..712734 | + | 750 | WP_003898528.1 | hypothetical protein | - |
| M1778_RS03260 (M1778_03260) | 712731..712973 | + | 243 | WP_003403210.1 | hypothetical protein | - |
| M1778_RS03265 (M1778_03265) | 713168..713395 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| M1778_RS03270 (M1778_03270) | 713392..713793 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| M1778_RS03275 (M1778_03275) | 713922..714005 | + | 84 | Protein_649 | galactose-1-phosphate uridylyltransferase | - |
| M1778_RS03280 (M1778_03280) | 714024..715106 | + | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
| M1778_RS03285 (M1778_03285) | 715103..716194 | + | 1092 | WP_003403225.1 | galactokinase | - |
| M1778_RS03290 (M1778_03290) | 716589..717746 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
| M1778_RS03295 (M1778_03295) | 717757..718704 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T244030 WP_003403218.1 NZ_CP096848:713392-713793 [Mycobacterium tuberculosis variant bovis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |