Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 705630..706273 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag M1778_RS03220 Protein ID WP_003403187.1
Coordinates 705872..706273 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag M1778_RS03215 Protein ID WP_003403184.1
Coordinates 705630..705875 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS03180 (M1778_03180) 700910..701440 - 531 WP_003917320.1 two component system sensor kinase HK2 -
M1778_RS03185 (M1778_03185) 701424..702119 - 696 WP_197044064.1 two-component system response regulator TcrA -
M1778_RS03190 (M1778_03190) 702242..702553 + 312 WP_003403164.1 hypothetical protein -
M1778_RS03195 (M1778_03195) 702625..703575 + 951 WP_003907436.1 DUF1259 domain-containing protein -
M1778_RS03200 (M1778_03200) 703816..704400 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
M1778_RS03205 (M1778_03205) 704402..705112 + 711 Protein_635 IS607 family element RNA-guided endonuclease TnpB -
M1778_RS03210 (M1778_03210) 705115..705585 + 471 WP_003898523.1 hypothetical protein -
M1778_RS03215 (M1778_03215) 705630..705875 + 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M1778_RS03220 (M1778_03220) 705872..706273 + 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
M1778_RS03225 (M1778_03225) 706264..706443 + 180 Protein_639 hypothetical protein -
M1778_RS03230 (M1778_03230) 706861..707058 - 198 WP_003403191.1 hypothetical protein -
M1778_RS03235 (M1778_03235) 707138..708295 - 1158 WP_079367680.1 hypothetical protein -
M1778_RS03240 (M1778_03240) 708347..708568 - 222 WP_003898525.1 DUF4926 domain-containing protein -
M1778_RS03245 (M1778_03245) 708710..709315 + 606 WP_003898526.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T244029 WP_003403187.1 NZ_CP096848:705872-706273 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT244029 WP_003403184.1 NZ_CP096848:705630-705875 [Mycobacterium tuberculosis variant bovis]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References