Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 699540..700186 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag M1778_RS03165 Protein ID WP_003403137.1
Coordinates 699540..699953 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag M1778_RS03170 Protein ID WP_003403139.1
Coordinates 699950..700186 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS03145 (M1778_03145) 695624..697173 + 1550 Protein_623 MlaD family protein -
M1778_RS03150 (M1778_03150) 697225..697617 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
M1778_RS03155 (M1778_03155) 697614..697871 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
M1778_RS03160 (M1778_03160) 698054..699289 - 1236 WP_003403128.1 ATP-binding protein -
M1778_RS03165 (M1778_03165) 699540..699953 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
M1778_RS03170 (M1778_03170) 699950..700186 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
M1778_RS03175 (M1778_03175) 700290..700796 - 507 WP_003900973.1 two component system sensor kinase HK1 -
M1778_RS03180 (M1778_03180) 700910..701440 - 531 WP_003917320.1 two component system sensor kinase HK2 -
M1778_RS03185 (M1778_03185) 701424..702119 - 696 WP_197044064.1 two-component system response regulator TcrA -
M1778_RS03190 (M1778_03190) 702242..702553 + 312 WP_003403164.1 hypothetical protein -
M1778_RS03195 (M1778_03195) 702625..703575 + 951 WP_003907436.1 DUF1259 domain-containing protein -
M1778_RS03200 (M1778_03200) 703816..704400 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
M1778_RS03205 (M1778_03205) 704402..705112 + 711 Protein_635 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T244028 WP_003403137.1 NZ_CP096848:c699953-699540 [Mycobacterium tuberculosis variant bovis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT244028 WP_003403139.1 NZ_CP096848:c700186-699950 [Mycobacterium tuberculosis variant bovis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References