Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-PHD
Location 697225..697871 Replicon chromosome
Accession NZ_CP096848
Organism Mycobacterium tuberculosis variant bovis strain Mb0486

Toxin (Protein)


Gene name vapC Uniprot ID O07783
Locus tag M1778_RS03150 Protein ID WP_003403122.1
Coordinates 697225..697617 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ86
Locus tag M1778_RS03155 Protein ID WP_003403125.1
Coordinates 697614..697871 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1778_RS03135 (M1778_03135) 692886..694414 + 1529 Protein_621 virulence factor Mce family protein -
M1778_RS03140 (M1778_03140) 694477..695619 + 1143 Protein_622 virulence factor Mce family protein -
M1778_RS03145 (M1778_03145) 695624..697173 + 1550 Protein_623 MlaD family protein -
M1778_RS03150 (M1778_03150) 697225..697617 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 Toxin
M1778_RS03155 (M1778_03155) 697614..697871 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 Antitoxin
M1778_RS03160 (M1778_03160) 698054..699289 - 1236 WP_003403128.1 ATP-binding protein -
M1778_RS03165 (M1778_03165) 699540..699953 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin -
M1778_RS03170 (M1778_03170) 699950..700186 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 -
M1778_RS03175 (M1778_03175) 700290..700796 - 507 WP_003900973.1 two component system sensor kinase HK1 -
M1778_RS03180 (M1778_03180) 700910..701440 - 531 WP_003917320.1 two component system sensor kinase HK2 -
M1778_RS03185 (M1778_03185) 701424..702119 - 696 WP_197044064.1 two-component system response regulator TcrA -
M1778_RS03190 (M1778_03190) 702242..702553 + 312 WP_003403164.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(8-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-53)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14080.08 Da        Isoelectric Point: 4.6558

>T244027 WP_003403122.1 NZ_CP096848:c697617-697225 [Mycobacterium tuberculosis variant bovis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI

Download         Length: 393 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9681.06 Da        Isoelectric Point: 7.0175

>AT244027 WP_003403125.1 NZ_CP096848:c697871-697614 [Mycobacterium tuberculosis variant bovis]
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTT
DDVRW

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4F8V4

Antitoxin

Source ID Structure
AlphaFold DB G0TQ86

References