Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 364757..365400 | Replicon | chromosome |
| Accession | NZ_CP096848 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0486 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFB8 |
| Locus tag | M1778_RS01600 | Protein ID | WP_003401566.1 |
| Coordinates | 364975..365400 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | O07227 |
| Locus tag | M1778_RS01595 | Protein ID | WP_003401563.1 |
| Coordinates | 364757..364978 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1778_RS01570 (M1778_01570) | 359831..360634 | - | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
| M1778_RS01575 (M1778_01575) | 360644..362041 | - | 1398 | WP_079367724.1 | sulfatase | - |
| M1778_RS01580 (M1778_01580) | 362220..364040 | + | 1821 | WP_003401546.1 | PE family protein | - |
| M1778_RS01585 (M1778_01585) | 364183..364410 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
| M1778_RS01590 (M1778_01590) | 364407..364709 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | - |
| M1778_RS01595 (M1778_01595) | 364757..364978 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
| M1778_RS01600 (M1778_01600) | 364975..365400 | + | 426 | WP_003401566.1 | PIN domain nuclease | Toxin |
| M1778_RS01605 (M1778_01605) | 365536..366168 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
| M1778_RS01610 (M1778_01610) | 366165..367073 | + | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
| M1778_RS01615 (M1778_01615) | 367081..367671 | - | 591 | WP_234712434.1 | hypothetical protein | - |
| M1778_RS01620 (M1778_01620) | 367664..367714 | - | 51 | Protein_320 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15713.90 Da Isoelectric Point: 5.6002
>T244024 WP_003401566.1 NZ_CP096848:364975-365400 [Mycobacterium tuberculosis variant bovis]
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3H87 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3H87 | |
| AlphaFold DB | A0A829CG48 |