Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3025321..3026000 | Replicon | chromosome |
Accession | NZ_CP096847 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb0531 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF90 |
Locus tag | M1773_RS14315 | Protein ID | WP_003414059.1 |
Coordinates | 3025321..3025737 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | M1773_RS14320 | Protein ID | WP_003414061.1 |
Coordinates | 3025734..3026000 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1773_RS14295 (M1773_14295) | 3021373..3022275 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
M1773_RS14300 (M1773_14300) | 3022344..3023096 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
M1773_RS14305 (M1773_14310) | 3023340..3023615 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
M1773_RS14310 (M1773_14315) | 3023612..3025234 | - | 1623 | WP_003414057.1 | class I SAM-dependent DNA methyltransferase | - |
M1773_RS14315 (M1773_14320) | 3025321..3025737 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
M1773_RS14320 (M1773_14325) | 3025734..3026000 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M1773_RS14325 (M1773_14330) | 3026026..3026421 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | - |
M1773_RS14330 (M1773_14335) | 3026418..3026687 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M1773_RS14335 (M1773_14340) | 3026697..3027791 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
M1773_RS14340 (M1773_14345) | 3027788..3028207 | - | 420 | Protein_2829 | winged helix-turn-helix domain-containing protein | - |
M1773_RS14345 (M1773_14350) | 3028206..3028280 | + | 75 | Protein_2830 | hypothetical protein | - |
M1773_RS14350 (M1773_14355) | 3028281..3028760 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
M1773_RS14355 (M1773_14360) | 3028831..3029631 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
M1773_RS14360 (M1773_14365) | 3029787..3030524 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T244009 WP_003414059.1 NZ_CP096847:c3025737-3025321 [Mycobacterium tuberculosis variant bovis]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|