Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2835861..2836498 | Replicon | chromosome |
Accession | NZ_CP096847 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb0531 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0DMV7 |
Locus tag | M1773_RS13300 | Protein ID | WP_003413180.1 |
Coordinates | 2835861..2836256 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ44 |
Locus tag | M1773_RS13305 | Protein ID | WP_003413183.1 |
Coordinates | 2836253..2836498 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1773_RS13260 (M1773_13260) | 2831946..2832605 | + | 660 | WP_003900846.1 | LppA family lipoprotein | - |
M1773_RS13265 (M1773_13265) | 2832602..2833261 | + | 660 | WP_003900847.1 | LppA family lipoprotein | - |
M1773_RS13270 (M1773_13270) | 2833258..2833920 | + | 663 | WP_003900848.1 | LppA family lipoprotein | - |
M1773_RS13275 (M1773_13275) | 2833917..2834195 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M1773_RS13280 (M1773_13280) | 2834288..2834701 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
M1773_RS13285 (M1773_13285) | 2834740..2834997 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | - |
M1773_RS13290 (M1773_13290) | 2834994..2835371 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
M1773_RS13295 (M1773_13295) | 2835387..2835761 | - | 375 | WP_003413177.1 | hypothetical protein | - |
M1773_RS13300 (M1773_13300) | 2835861..2836256 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | Toxin |
M1773_RS13305 (M1773_13305) | 2836253..2836498 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | Antitoxin |
M1773_RS13310 (M1773_13310) | 2836909..2837328 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
M1773_RS13315 (M1773_13315) | 2837340..2838148 | - | 809 | Protein_2628 | shikimate dehydrogenase | - |
M1773_RS13320 (M1773_13320) | 2838145..2839398 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
M1773_RS13325 (M1773_13325) | 2839391..2839903 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14619.53 Da Isoelectric Point: 6.9794
>T244007 WP_003413180.1 NZ_CP096847:c2836256-2835861 [Mycobacterium tuberculosis variant bovis]
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5WZ4 | |
PDB | 5WZF |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW31 |