Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2819745..2820385 | Replicon | chromosome |
Accession | NZ_CP096847 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb0531 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ08 |
Locus tag | M1773_RS13190 | Protein ID | WP_003412970.1 |
Coordinates | 2819745..2820164 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ09 |
Locus tag | M1773_RS13195 | Protein ID | WP_003412975.1 |
Coordinates | 2820161..2820385 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1773_RS13160 (M1773_13160) | 2815330..2816052 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
M1773_RS13165 (M1773_13165) | 2816569..2816796 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M1773_RS13170 (M1773_13170) | 2816793..2817194 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
M1773_RS13175 (M1773_13175) | 2817229..2818149 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
M1773_RS13180 (M1773_13180) | 2818490..2818696 | - | 207 | WP_234712436.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
M1773_RS13185 (M1773_13185) | 2818794..2819744 | + | 951 | WP_003911916.1 | ERCC4 domain-containing protein | - |
M1773_RS13190 (M1773_13190) | 2819745..2820164 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M1773_RS13195 (M1773_13195) | 2820161..2820385 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
M1773_RS13200 (M1773_13200) | 2820416..2823259 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
M1773_RS13205 (M1773_13205) | 2823331..2823732 | - | 402 | WP_003412981.1 | hypothetical protein | - |
M1773_RS13210 (M1773_13210) | 2823732..2824202 | - | 471 | WP_003412985.1 | transcription antitermination factor NusB | - |
M1773_RS13215 (M1773_13215) | 2824205..2824768 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T244004 WP_003412970.1 NZ_CP096847:c2820164-2819745 [Mycobacterium tuberculosis variant bovis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|