Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1016700..1017319 | Replicon | chromosome |
Accession | NZ_CP096847 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb0531 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | M1773_RS04840 | Protein ID | WP_003404726.1 |
Coordinates | 1016885..1017319 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | G0TFQ5 |
Locus tag | M1773_RS04835 | Protein ID | WP_003404724.1 |
Coordinates | 1016700..1016879 (+) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1773_RS04820 (M1773_04815) | 1012173..1013753 | + | 1581 | WP_011799139.1 | serine hydrolase | - |
M1773_RS04825 (M1773_04820) | 1013750..1016143 | + | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
M1773_RS04830 (M1773_04825) | 1016416..1016574 | + | 159 | WP_003404720.1 | hypothetical protein | - |
M1773_RS04835 (M1773_04830) | 1016700..1016879 | + | 180 | WP_003404724.1 | antitoxin | Antitoxin |
M1773_RS04840 (M1773_04835) | 1016885..1017319 | + | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
M1773_RS04845 (M1773_04840) | 1017417..1018190 | + | 774 | WP_003404735.1 | VOC family protein | - |
M1773_RS04850 (M1773_04845) | 1018255..1018704 | + | 450 | WP_003404738.1 | hypothetical protein | - |
M1773_RS04855 (M1773_04850) | 1018839..1019069 | - | 231 | WP_003898642.1 | hypothetical protein | - |
M1773_RS04860 (M1773_04855) | 1019236..1020744 | - | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
M1773_RS04865 (M1773_04860) | 1020746..1021984 | - | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T243979 WP_003404726.1 NZ_CP096847:1016885-1017319 [Mycobacterium tuberculosis variant bovis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|