Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 757487..758027 | Replicon | chromosome |
Accession | NZ_CP096847 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb0531 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P9WII0 |
Locus tag | M1773_RS03510 | Protein ID | WP_003403376.1 |
Coordinates | 757487..757795 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TQE0 |
Locus tag | M1773_RS03515 | Protein ID | WP_003403381.1 |
Coordinates | 757782..758027 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1773_RS03485 (M1773_03480) | 752802..754307 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
M1773_RS03490 (M1773_03485) | 754388..755398 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
M1773_RS03495 (M1773_03490) | 755786..756169 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
M1773_RS03500 (M1773_03495) | 756264..756419 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M1773_RS03505 (M1773_03500) | 756495..757211 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
M1773_RS03510 (M1773_03505) | 757487..757795 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M1773_RS03515 (M1773_03510) | 757782..758027 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
M1773_RS03520 (M1773_03515) | 758137..758574 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
M1773_RS03525 (M1773_03520) | 758571..758825 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
M1773_RS03530 (M1773_03525) | 758939..761302 | + | 2364 | WP_003403397.1 | arylsulfatase AtsD | - |
M1773_RS03535 (M1773_03530) | 761365..761691 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
M1773_RS03540 (M1773_03535) | 761603..761941 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
M1773_RS03545 (M1773_03540) | 761938..762111 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11320.10 Da Isoelectric Point: 11.6554
>T243975 WP_003403376.1 NZ_CP096847:c757795-757487 [Mycobacterium tuberculosis variant bovis]
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSE5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQE0 |