Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
| Location | 364185..364711 | Replicon | chromosome |
| Accession | NZ_CP096847 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb0531 | ||
Toxin (Protein)
| Gene name | Rv0299 | Uniprot ID | - |
| Locus tag | M1773_RS01595 | Protein ID | WP_003401560.1 |
| Coordinates | 364409..364711 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | Rv0298 | Uniprot ID | P9WJ08 |
| Locus tag | M1773_RS01590 | Protein ID | WP_003401555.1 |
| Coordinates | 364185..364412 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1773_RS01575 (M1773_01570) | 359833..360636 | - | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
| M1773_RS01580 (M1773_01575) | 360646..362043 | - | 1398 | WP_003401544.1 | sulfatase | - |
| M1773_RS01585 (M1773_01580) | 362222..364042 | + | 1821 | WP_273610540.1 | PE family protein | - |
| M1773_RS01590 (M1773_01585) | 364185..364412 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| M1773_RS01595 (M1773_01590) | 364409..364711 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
| M1773_RS01600 (M1773_01595) | 364759..364980 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | - |
| M1773_RS01605 (M1773_01600) | 364977..365402 | + | 426 | WP_003401566.1 | PIN domain nuclease | - |
| M1773_RS01610 (M1773_01605) | 365538..366170 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
| M1773_RS01615 (M1773_01610) | 366167..367075 | + | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
| M1773_RS01620 (M1773_01615) | 367083..367673 | - | 591 | WP_234712434.1 | hypothetical protein | - |
| M1773_RS01625 (M1773_01620) | 367666..367716 | - | 51 | Protein_321 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T243963 WP_003401560.1 NZ_CP096847:364409-364711 [Mycobacterium tuberculosis variant bovis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|