Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Txe-YefM |
| Location | 3712212..3712741 | Replicon | chromosome |
| Accession | NZ_CP096846 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TI95 |
| Locus tag | M1775_RS17445 | Protein ID | WP_003417760.1 |
| Coordinates | 3712484..3712741 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0TI94 |
| Locus tag | M1775_RS17440 | Protein ID | WP_003417757.1 |
| Coordinates | 3712212..3712487 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1775_RS17405 (M1775_17400) | 3708785..3709474 | - | 690 | WP_003917774.1 | BBE domain-containing protein | - |
| M1775_RS17410 (M1775_17405) | 3709661..3710032 | - | 372 | WP_003417739.1 | FAD-binding protein | - |
| M1775_RS17415 (M1775_17410) | 3709930..3710148 | - | 219 | WP_157132559.1 | hypothetical protein | - |
| M1775_RS17420 (M1775_17415) | 3710175..3710435 | - | 261 | WP_003417741.1 | hypothetical protein | - |
| M1775_RS17425 (M1775_17420) | 3710550..3710939 | + | 390 | WP_010950876.1 | DUF732 domain-containing protein | - |
| M1775_RS17430 (M1775_17425) | 3710953..3711246 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
| M1775_RS17435 (M1775_17430) | 3711243..3712088 | - | 846 | WP_010950877.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
| M1775_RS17440 (M1775_17435) | 3712212..3712487 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
| M1775_RS17445 (M1775_17440) | 3712484..3712741 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
| M1775_RS17450 (M1775_17445) | 3712783..3713973 | + | 1191 | WP_003900033.1 | NADH:flavin oxidoreductase | - |
| M1775_RS17455 (M1775_17450) | 3714090..3714458 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
| M1775_RS17460 (M1775_17455) | 3714455..3715006 | - | 552 | WP_003417767.1 | pentapeptide repeat protein MfpA | - |
| M1775_RS17465 (M1775_17460) | 3715013..3715594 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
| M1775_RS17470 (M1775_17465) | 3715575..3715943 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
| M1775_RS17475 (M1775_17470) | 3715921..3716313 | - | 393 | WP_011799344.1 | serine protease inhibitor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T243959 WP_003417760.1 NZ_CP096846:3712484-3712741 [Mycobacterium tuberculosis variant bovis]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|