Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3651844..3652518 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF52 |
Locus tag | M1775_RS17230 | Protein ID | WP_003417282.1 |
Coordinates | 3651844..3652272 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | M1775_RS17235 | Protein ID | WP_003417286.1 |
Coordinates | 3652276..3652518 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS17205 (M1775_17200) | 3647666..3648067 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
M1775_RS17210 (M1775_17205) | 3648304..3648642 | + | 339 | WP_003417267.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
M1775_RS17215 (M1775_17210) | 3648639..3649073 | + | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
M1775_RS17220 (M1775_17215) | 3649202..3650974 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
M1775_RS17225 (M1775_17220) | 3650974..3651765 | + | 792 | WP_010950870.1 | succinate dehydrogenase iron-sulfur subunit | - |
M1775_RS17230 (M1775_17225) | 3651844..3652272 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M1775_RS17235 (M1775_17230) | 3652276..3652518 | - | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
M1775_RS17240 (M1775_17235) | 3652640..3653254 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
M1775_RS17245 (M1775_17240) | 3653251..3653916 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
M1775_RS17250 (M1775_17245) | 3653917..3654450 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
M1775_RS17255 (M1775_17250) | 3654447..3654821 | - | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
M1775_RS17260 (M1775_17255) | 3654918..3655922 | - | 1005 | WP_003914475.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T243958 WP_003417282.1 NZ_CP096846:c3652272-3651844 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBL0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TI59 |