Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3128844..3129531 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | M1775_RS14875 | Protein ID | WP_003414624.1 |
Coordinates | 3129088..3129531 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | M1775_RS14870 | Protein ID | WP_003414620.1 |
Coordinates | 3128844..3129101 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS14850 (M1775_14845) | 3124164..3125018 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
M1775_RS14855 (M1775_14850) | 3125074..3126237 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
M1775_RS14860 (M1775_14855) | 3126254..3127468 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
M1775_RS14865 (M1775_14860) | 3127476..3128717 | - | 1242 | WP_273585964.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
M1775_RS14870 (M1775_14865) | 3128844..3129101 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
M1775_RS14875 (M1775_14870) | 3129088..3129531 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M1775_RS14880 (M1775_14875) | 3129611..3130273 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
M1775_RS14885 (M1775_14880) | 3130369..3130560 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
M1775_RS14890 (M1775_14885) | 3130892..3132640 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
M1775_RS14895 (M1775_14890) | 3132736..3133317 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
M1775_RS14900 (M1775_14895) | 3133417..3133683 | + | 267 | WP_031657293.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T243956 WP_003414624.1 NZ_CP096846:3129088-3129531 [Mycobacterium tuberculosis variant bovis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|