Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3123243..3123791 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | M1775_RS14845 | Protein ID | WP_003414602.1 |
Coordinates | 3123528..3123791 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | M1775_RS14840 | Protein ID | WP_003414599.1 |
Coordinates | 3123243..3123524 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS14815 (M1775_14810) | 3118866..3119723 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
M1775_RS14820 (M1775_14815) | 3119765..3120349 | - | 585 | WP_010950792.1 | DUF1707 domain-containing protein | - |
M1775_RS14825 (M1775_14820) | 3120453..3120701 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
M1775_RS14830 (M1775_14825) | 3120698..3121078 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
M1775_RS14835 (M1775_14830) | 3121160..3122971 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
M1775_RS14840 (M1775_14835) | 3123243..3123524 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
M1775_RS14845 (M1775_14840) | 3123528..3123791 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M1775_RS14850 (M1775_14845) | 3124164..3125018 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
M1775_RS14855 (M1775_14850) | 3125074..3126237 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
M1775_RS14860 (M1775_14855) | 3126254..3127468 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
M1775_RS14865 (M1775_14860) | 3127476..3128717 | - | 1242 | WP_273585964.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T243955 WP_003414602.1 NZ_CP096846:3123528-3123791 [Mycobacterium tuberculosis variant bovis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|