Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3082380..3082984 Replicon chromosome
Accession NZ_CP096846
Organism Mycobacterium tuberculosis variant bovis strain Mb2377

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag M1775_RS14645 Protein ID WP_003414492.1
Coordinates 3082380..3082772 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag M1775_RS14650 Protein ID WP_003414495.1
Coordinates 3082769..3082984 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1775_RS14615 (M1775_14615) 3077530..3078318 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
M1775_RS14620 (M1775_14620) 3078652..3079197 - 546 WP_003904931.1 DUF1802 family protein -
M1775_RS14625 (M1775_14625) 3079469..3080353 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M1775_RS14630 (M1775_14630) 3080356..3081243 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
M1775_RS14635 (M1775_14635) 3081548..3082093 - 546 WP_003899500.1 DUF1802 family protein -
M1775_RS14640 (M1775_14640) 3082090..3082359 - 270 WP_003414489.1 DUF2277 family protein -
M1775_RS14645 (M1775_14645) 3082380..3082772 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
M1775_RS14650 (M1775_14650) 3082769..3082984 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M1775_RS14655 (M1775_14655) 3083031..3083780 + 750 WP_003414497.1 enoyl-CoA hydratase -
M1775_RS14660 (M1775_14660) 3083859..3084941 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
M1775_RS14665 (M1775_14665) 3084934..3086244 - 1311 WP_031702645.1 ABC transporter substrate-binding protein -
M1775_RS14670 (M1775_14670) 3086247..3087074 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
M1775_RS14675 (M1775_14675) 3087071..3087982 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T243954 WP_003414492.1 NZ_CP096846:c3082772-3082380 [Mycobacterium tuberculosis variant bovis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT243954 WP_003414495.1 NZ_CP096846:c3082984-3082769 [Mycobacterium tuberculosis variant bovis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References