Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3059626..3060196 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | M1775_RS14515 | Protein ID | WP_003414166.1 |
Coordinates | 3059626..3059982 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | M1775_RS14520 | Protein ID | WP_003901465.1 |
Coordinates | 3059966..3060196 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS14495 (M1775_14495) | 3055078..3056766 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
M1775_RS14500 (M1775_14500) | 3056770..3057096 | - | 327 | WP_003414157.1 | hypothetical protein | - |
M1775_RS14505 (M1775_14505) | 3057269..3057856 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
M1775_RS14510 (M1775_14510) | 3057875..3059524 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
M1775_RS14515 (M1775_14515) | 3059626..3059982 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
M1775_RS14520 (M1775_14520) | 3059966..3060196 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
M1775_RS14525 (M1775_14525) | 3060239..3061282 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
M1775_RS14530 (M1775_14530) | 3061281..3061748 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
M1775_RS14535 (M1775_14535) | 3061924..3062178 | - | 255 | WP_003917684.1 | hypothetical protein | - |
M1775_RS14540 (M1775_14540) | 3062340..3062531 | + | 192 | WP_003414184.1 | hypothetical protein | - |
M1775_RS14545 (M1775_14545) | 3062748..3063008 | + | 261 | Protein_2870 | transposase | - |
M1775_RS14550 (M1775_14550) | 3064118..3064375 | + | 258 | WP_003899489.1 | hypothetical protein | - |
M1775_RS14555 (M1775_14555) | 3064480..3064791 | + | 312 | WP_010950777.1 | hypothetical protein | - |
M1775_RS14560 (M1775_14560) | 3064813..3065049 | - | 237 | Protein_2873 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T243952 WP_003414166.1 NZ_CP096846:c3059982-3059626 [Mycobacterium tuberculosis variant bovis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|