Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3020043..3020730 | Replicon | chromosome |
| Accession | NZ_CP096846 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TF65 |
| Locus tag | M1775_RS14295 | Protein ID | WP_003414064.1 |
| Coordinates | 3020335..3020730 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TF64 |
| Locus tag | M1775_RS14290 | Protein ID | WP_003414061.1 |
| Coordinates | 3020043..3020309 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1775_RS14265 (M1775_14260) | 3015682..3016584 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| M1775_RS14270 (M1775_14265) | 3016653..3017405 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
| M1775_RS14275 (M1775_14275) | 3017649..3017924 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
| M1775_RS14280 (M1775_14280) | 3017921..3019543 | - | 1623 | WP_003414057.1 | class I SAM-dependent DNA methyltransferase | - |
| M1775_RS14285 (M1775_14285) | 3019630..3020046 | - | 417 | WP_273585961.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
| M1775_RS14290 (M1775_14290) | 3020043..3020309 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M1775_RS14295 (M1775_14295) | 3020335..3020730 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1775_RS14300 (M1775_14300) | 3020727..3020996 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M1775_RS14305 (M1775_14305) | 3021006..3022100 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
| M1775_RS14310 (M1775_14310) | 3022097..3022516 | - | 420 | Protein_2823 | winged helix-turn-helix domain-containing protein | - |
| M1775_RS14315 (M1775_14315) | 3022515..3022589 | + | 75 | Protein_2824 | hypothetical protein | - |
| M1775_RS14320 (M1775_14320) | 3022590..3023069 | - | 480 | WP_273586093.1 | dihydrofolate reductase | - |
| M1775_RS14325 (M1775_14325) | 3023140..3023940 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
| M1775_RS14330 (M1775_14330) | 3024096..3024833 | + | 738 | WP_011799288.1 | dienelactone hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T243951 WP_003414064.1 NZ_CP096846:c3020730-3020335 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|